PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00027.1.g02990.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 318aa    MW: 34320.2 Da    PI: 5.3594
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00027.1.g02990.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.23.3e-071650136
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36
                                  +g W++eEde+l++ + + G g+W+++++  g + t
  Zjn_sc00027.1.g02990.1.am.mk 16 KGLWSPEEDEKLYNHIIRRGVGCWSSVPKLAG-KHT 50
                                  678***************************99.655 PP

2Myb_DNA-binding52.11.5e-1680123146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg+++++E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++
  Zjn_sc00027.1.g02990.1.am.mk  80 RGSFSQQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 123
                                   899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.4221158IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-121177IPR009057Homeodomain-like
SuperFamilySSF466892.87E-2013121IPR009057Homeodomain-like
SMARTSM007171.51576IPR001005SANT/Myb domain
PfamPF002491.9E-51650IPR001005SANT/Myb domain
PROSITE profilePS5129425.40875129IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-2678129IPR009057Homeodomain-like
SMARTSM007176.1E-1679127IPR001005SANT/Myb domain
PfamPF002499.8E-1580123IPR001005SANT/Myb domain
CDDcd001677.45E-1282122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRLSGGVGV QPKLRKGLWS PEEDEKLYNH IIRRGVGCWS SVPKLAGKHT HAHSPAGTLF  60
YRSLPRTLRW INYLRPDLKR GSFSQQEEDL IVALHEILGN RWSQIASHLP GRTDNEIKNF  120
WNSCVKKKLR QRGIDPSTHK PIAGGAGAAE AAAAALPDQD QDHKPAAEGA AAPKQQVALD  180
PFPVMTDFGG CGFDQLGVAN VAALYGQFDY DVGKASDAAA GFVADYSSVL DVSENLGYGE  240
SSSNSSNWNC AEIGSVLDSE VLDWASGAGV KAEPFTEMVR QHSGGGEVDD DALEHTFALP  300
AGCQEQSLAH FDFNLEYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21121293108B-MYB
1h8a_C3e-211012921128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0635975e-94BT063597.1 Zea mays full-length cDNA clone ZM_BFc0084D02 mRNA, complete cds.
GenBankKJ7274945e-94KJ727494.1 Zea mays clone pUT5353 MYB transcription factor (MYB99) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.11e-142PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-112MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3Z8601e-142K3Z860_SETIT; Uncharacterized protein
STRINGSi022730m1e-142(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-60myb domain protein 86